Svenska | Ungerska medicinsk |
---|
interferon beta | béta-interferon [Interferonum beta]infobeta interferons have been shown to slow down activity and disease progression in MS |
interferon gamma-1b | gamma-1b-interferon [Interferonum gamma-1b]infointerferon gamma-1b injection, used to reduce the frequency and severity of serious infections in people with chronic granulomatous disease |
interferon gamma-1b-lösning, koncentrerad | tömény gamma-1b-interferonoldat [Interferoni gamma- 1b solutio concentrata]infointerferon gamma-1b concentrated solution, a solution of the N-terminal methionyl form of interferon gamma, a protein which is produced and secreted by human antigen-stimulated T lymphocytes in response to viral infections and various other inducers |
interferonefekt -en -er | interferonhatás [effectus Interferoni]infointerferon effect |
interferonliknande | interferonhoz hasonló · interferonszerűinfointerferon-like |
interferonmedicin -en -er | interferon-gyógyszerinfointerferon medicine |
interferonpreparat -et - | interferonkészítmény [praeparatum interferoni]infointerferon preparation |
jättecellsgranulom perifert i gingiva | fogíny perifériás óriássejtes granulomája [peripheral giant cell granuloma of gingiva]infoperipheral giant cell granuloma of gingiva, a reactive proliferation caused by chronic irritation of the gingival mucosa |
kalciferol -en | Kalciferol [vitaminum D, Calciferolum]infoCalciferol, one of the D vitamins [vitamin D2], a sterol that is formed when its isomer ergosterol is exposed to ultraviolet light, and which is routinely added to dairy products |
kaliumferrocyanid -en -er | ferro-ciánkálium · kálium-ferrocianid · kálium-hexaciano-ferrát · sárgavérlúgsó [Kalium ferrocyanatum]infopotassium ferrocyanide, used in some medicines and medicines containing calcium or iron |
karbamoyltransferas -en -er infoenzym | karbamoil transzferázinfoOrnithine transcarbamylase, OTC, ornithine carbamoyltransferase enzyme, catalyzes the reaction between carbamoyl phosphate, CP, and ornithine |
karboanhydras ferment | karboanhidráz-fermentuminfoCarbonic anhydrase ferment, carbonate dehydratase enzyme |
kärl som i fostret förbinder navelvenen med vena cava inferior | vénás vezeték [ductus venosus]infovenous conduit, vessel that in the fetus connects the umbilical vein with the inferior vena cava |
ketonstoffer i urinen infoketonuri | ketontestek ürülése a vizelettel [ketonuria, acetonuria]infoketonuria, acetonuria, the presence of excess ketone bodies in the urine in conditions [as diabetes mellitus and starvation acidosis] |
kloramfenikol acetyltransferas infoenzym | Kloramfenikol acetil transzferázinfoChloramphenicol acetyltransferase enzyme, responsible for high-level bacterial resistance to the antibiotic chloramphenicol |
klorfenol-kamfer -n | Klórfenol-kámfor [gyökércsatorna tisztító oldat] [Chlorophenolum, Camphorum]infoCamphorated para chlorophenol Liq., disinfection of the dentine after cavity preparation |
Kofferath-syndrom -et - | Kofferath-szindrómainfoKofferath syndrome, unilateral paralysis in newborns often caused by forceps during delivery |
kolekalciferol -et | Kolekalciferol [Cholecalciferolum]infoCholecalciferol, colecalciferol, vitamin D3, a type of vitamin D that is made by the skin when exposed to sunlight |
kolekalciferolkoncentrat -et - infovattendispergerbar form | Kolekalciferol-koncentrátum [vízben diszpergálható forma] [Cholecalciferolum in aqua dispergibile]infoCholecalciferol concentrate, extra vitamin D3 in water dispersible form |
koncentrerad interferon alpha-2-lösning | tömény alfa-2-interferonoldat [Interferoni alfa-2 solutio concentrata]infoalpha-2 interferon concentrated solution, helps the immune system fight viral infections [chronic hepatitis C, Philadelphia chromosome positive chronic myelogenous leukemia, hairy cell leukemia] |
koncentrerad interferon gamma-1b-lösning | tömény gamma-1b-interferonoldat [Interferoni gamma-1b solutio concentrata]infogamma-1b-interferon concentrated solution, used for the treatment of chronic granulomatous disease and osteopetrosis |
kongenital infertilitet | világrahozott meddőség [f.r.] [infertilitas connatalis]infoconnatal infertility |
Kupffercell -en -er | Kupffersejt · Kupffer-csillagsejtinfoKupffer cells, Kupffer–Browicz cells, stellate macrophages, liver-specific mesenchymal cells that play vital roles in liver physiology and fibrogenesis |
lactoferrin -et | Laktoferrin [Lactoferrinum]infoLactoferrin, [LF, a component of the whey protein of milk of most mammals, probably with the exception of dogs and rats |
laktoferrin -et | B2-vitamin [riboflavinum, lactoflavinum, vitaminum B2]infoLactoferrin, lactotransferrin, LTF, a multifunctional, antibacterial, antiviral, anti-cancer protein |
laterotrusionsinterferens -en -er infointerferens vid sidorörelser av UK | fogérintkezések az állkapocsízület oldalfelé mozgásakorinfotooth contacts during lateral movement of the jaw joint |
lecitin-kolesterol-acyltransferas -en -er infoenzym | lecitin-koleszterin acil-transzferázinfolecithin-cholesterol acyltransferase enyzme, LCAT, a plasma enzyme that esterifies cholesterol and raises high-density lipoprotein cholesterol |
leukaferes -en -er | fehérvérsejtek aferezises összegyűjtése [leukapheresis]infoleukapheresis, performed in cancer patients to harvest stem cells, manufacture therapeutic vaccines, follow immunologic response to therapy |
leukocytinterferon -et - | leukocitainterferon [leucocyte interferon, lymphoblast interferon, alpha interferon]infointerferon-alpha,s produced predominantly by B lymphocytes but may be derived from leukocytes, lymphoblasts or by recombinant DNA technology |
luciferas -et infoenzym | luciferáz [enzim] [Luciferase]infoluciferase enzyme, catalyses the oxidation of a luciferin, causing it to produce a visible glow |
membranproliferativ glomerulonefrit | membránproliferativ glomerulonephritis [glomerulonephritis membranoproliferativa]infomembranoproliferative glomerulonephritis, MPGN, a pattern of glomerular injury on kidney biopsy with characteristic light microscopic changes, including hypercellularity and thickening of the glomerular basement membrane, GBM |
metod Töpfer | Töpfer-eljárás [gyomorsav kimutatása]infoToepfer test for free hydrochloric acid |
mikrocystoid retinal perifer degeneration | microcystás ideghártya-degeneráció [degeneratio retinae microcystica]infomicrocystic degeneration of the retina, a cluster of tiny vesicles or vacuole, it involves the middle and outer retina, limited by the inner plexiform layer |
mjölkkoagulerande ferment av bukspott | pancreasnedv tejalvasztó fermentuma [chimotrypsinogen]infochymotrypsinogen, enzyme, hydrolytically cleave peptide bonds |
musculus obliquus inferior | alsó ferde szemizom [musculus obliquus inferior]infolower oblique eye muscle, esponsible for extorsion, elevation, and abduction |
musculus rectus inferior | alsó egyenes szemizom [musculus rectus inferior]infoinferior rectus eye muscle, located at the bottom part of the eye and allows the eye to move downward |
muskelkarnitinpalmityltransferas -en -er infoenzym | izom-karnitin-palmitiltranszferázinfomuscle carnitine palmitoyltransferase enzyme, CPT, catalyzes the transfer of long- and medium-chain fatty acids from cytoplasm into mitochondria, where oxidation of fatty acids takes place |
muskelkarnitinpalmityltransferasbrist -en -er | izom-karnitin-palmitiltranszferáz enzimhiányinfomuscle carnitine palmitoyltransferase deficiency |
myeloproliferativ sjukdom | myeoloproliferatív betegséginfomyeloproliferative disease, a heterogeneous group of disorders characterized by cellular proliferation of one or more hematologic cell |
myeoloproliferativ -t -a | myeoloproliferatív [myeoloproliferativus]infomyeloproliferative, associated with excessive bone marrow production of one or more blood cell types |