Svéd | Magyar orvosi |
---|
fibrinogenbrist -en -er | fibrinogén hiány [afibrinogenemia, hypofibrinogenemia]infoafibrinogenemia, a bleeding disorder caused by impairment of the blood clotting process |
folatbrist -en -er | folsavas só hiánya · foláthiány · fólsavhiány · pantothensav hiány [deficientia acidi folici]infofolic acid deficiency, can arise from multiple causes, including inadequate dietary intake |
folsyrabrist -en -er | folsavhiány [deficientia Acidi folici]infofolic deficiency, folic acid deficiency, a lack of dietary folate, |
fosfoenolpyruvatkarboxykinasbrist -en -er | foszfo-enol-piruvát-karboxi-kinázhiányinfophosphoenolpyruvate carboxykinase deficiency |
fosfofruktokinasbrist -en -er infoenzym | foszfofruktokináz hiányinfophosphofructokinase deficiency |
fosforbrist -en -er | foszforhiányinfophosphorus deficiency, hypophosphatemia |
fruktos-1,6-difosfatbrist -en -er | fruktóz-1,6-bifoszfát hiányinfofructose-1,6-biphosphate deficiency |
G-6-PD-brist -en -er | G-6-PD-hiány [glükóz-6-foszfát-dehydrogenáz ezim hiány]infoG-6-PD-deficiency, glucose-6-phosphate dehydrogenase enzyme deficiency |
galaktokinasbrist -en -er | galaktokináz enzimhiányinfogalactokinase enzyme deficiency |
gammaglobulinbrist -en -er | gamma-globulin hiány [agammaglobulinaema]infoagammaglobulinemia, inherited disorder in which a person has very low levels of immunoglobulins |
Glykos-6-fosfatdehydrogenasbrist -en -er | glükóz-6-foszfát-dehidrogenáz [G6PD] enzimhiányinfoglucose-6-phosphate dehydrogenase, G6PD, enzyme deficiency, a condition in which red blood cells break down when the body is exposed to certain drugs or the stress of infection |
gonadotropinbrist -en -er | gonadotropinhiányinfogonadotropin deficiency |
Hagemanfaktorbrist -en -er infoF12-brist, faktor XII-brist, HAF-brist, Hageman-drag | Hageman-szindrómainfofactor XII Deficiency, a deficiency of the factor XII [Hageman factor] |
hexokinasbrist -en -er | hexokinázhiányinfohexokinase deficiency, a rare disease where the predominant clinical effect is nonspherocytic hemolytic anemia |
hexosaminidas A-brist -en -er | hexozaminidáz A hiánya [GM2-gangliosidosis]infohexosaminidase A deficiency, HEX A deficiency, caused by mutations in the HEXA gene, an inherited disease that causes brain and other nerve cells to die |
hexosaminidas B-brist -en -er | hexozaminidáz B hiánya [GM2-gangliosidosis]infohexosaminidase B deficiency,deficiency of hexosaminidase B, causes an almost identical phenotype named Sandhoff disease, in which organomegaly may occur |
HGPRT-brist -en -er infohypoxantin-guanin-fosforibisil-transferas-brist | Lesch-Nyhan-szindrómainfoLesch-Nyhan syndrome, LNS, a rare, inherited disorder caused by a deficiency of the enzyme hypoxanthine-guanine phosphoribosyltransferase, HPRT |
hormonbrist -en -er | hormonhiány [deficientia hormoni]infohormone deficiency |
impulskontrollbrist -en -er | impulzuskontrollhiányinfolack of impulse control |
insulinbrist -en -er | inzulinhiány [deficientia insulini]infoinsulin deficiency |
integrinbrist -en -er | integrinhiányinfointegrin deficiency |
karboxylasbrist -en -er infoenzym | karboxilázhiány [deficientia carboxylasi]infoCarboxylase deficiency, deficient activities of three biotin-dependent enzymes, propionyl coenzyme A carboxylase, pyruvate carboxylase, and beta-methylcrotonyl coenzyme A carboxylase |
karnitinbrist -en -er | karnitinhiány [deficientia carnitini]infoCarnitine deficiency, inadequate intake of or inability to metabolize the amino acid carnitine, can cause muscle weakness, heart and liver problems |
katalasbrist -en -er | katalázenzim-hiány [catalase deficiency]infocatalase deficiency, excessive accumulation of hydrogen peroxide due to insufficient decomposition, it is highly toxic at higher concentrations |
koagulationsfaktorbrist -en -er | véralvadási faktor hiánya [deficientia factoris coagulationis]infolack of coagulation factor |
kortikosteroidbrist -en -er | kortikoszteroidhiány [hypocorticalismus]infohypocortisolism, the adrenal glands fail to produce adequate levels of steroid hormones, mostly cortisol and to a certain degree aldosterone |
kortisonbrist -en -er | kortizonhiány [deficientia Cortisoni]infoCortisone deficiency |
lactoflavinbrist -en -er | Laktoflavinhiány [alactoflavinum, avitamin B2]infoLactoflavin deficiency, Riboflavin deficiency, avitaminosis B2, ariboflavinosis |
leverfosforylasbrist -en -er infoenzymbrist | májfoszforiláz hiányinfoliver phosphorylase deficiency, Hers disease, is usually a mild form of glycogenosis, glycogen storage disease type VI, GSDVI |
lipoproteinbrist -en -er | lipoproteinhiányinfolipoprotein deficiencies: abetalipoproteinaemia, familial hypobetalipoproteinaemia, and familial alpha lipoprotein deficiency |
meso-inositolbrist -en -er | mezo-inozitol hiány [myo-inozit hiány]infoMeso-inositol deficiency, Myo-inositol deficiency, leads to intestinal lipodystrophy in animals and 'inositol-less death' in some fungi |
Mg-brist -en -er infomagnesium-brist | Mg-hiányinfoMg deficiency, Magnesium deficiency |
multipel koenzym A-dehydrogenasbrist -en -er | többszörös acyl-Coa dehydrogenase enzimhiányinfomultiple acyl-coA dehydrogenase deficiency, electron transfer flavoprotein dehydrogenase deficiency, glutaric acidemia II, glutaric aciduria II, MADD |
muskelkarnitinpalmityltransferasbrist -en -er | izom-karnitin-palmitiltranszferáz enzimhiányinfomuscle carnitine palmitoyltransferase deficiency |
myofosforylasbrist -en -er | myofoszforilázdefektusinfodeficiency of myophosphorylase, McArdle disease, occurs due to the deficiency or absence of an enzyme called myophosphorylase |
natriumbrist -en -er | nátrium-hiány [hyponatraemia]infohyponatremia, the Sodium level in the blood is below normal |
niacinbrist -en -er infonikotinamidbrist | niacinhiány [pellagra]infoNiacin deficiency, pellagra |
östrogenbrist -en -er | ösztrogénhiány [deficientia oestrogeni]infoestrogen deficiency |
pantotensyrabrist -en -er | pantoténsavhiány [deficientia acidi ipantothenici, avitaminosis B5]infoPantothenic acid deficiency, avitaminosis B5, cause numbness and burning of the hands and feet, headache, extreme tiredness, irritability, restlessness, sleeping problems, stomach pain, heartburn, diarrhea, nausea, vomiting, and loss of appetite |
sädesbrist -en -er | ondósejthiány [aspermatismus]infoaspermatism, the non-emission of semen in the sexual orgasm, owing to its reflux into the bladder |